SGCZ Polyclonal AntibodySGCZ Polyclonal Antibody
Move your mouse over image or click to enlarge

SGCZ Polyclonal Antibody

Cat# Size Price Qty Buy
A15958-20ul 20ul
£77.00
A15958-50ul 50ul
£113.75
A15958-100ul 100ul
£192.50
A15958-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15958
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SGCZ; ZSG1; zeta-sarcoglycan
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 83-312 of human SGCZ (NP_631906.2).
Reactivity Mouse, Rat
Gene ID 137868
Calculated MW 32kDa/34kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence NLRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYLSPAGVGSTCQSSSNICLWS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents