SF3B5 Polyclonal AntibodySF3B5 Polyclonal Antibody
Move your mouse over image or click to enlarge

SF3B5 Polyclonal Antibody

Cat# Size Price Qty Buy
A15905-20ul 20ul
£77.00
A15905-50ul 50ul
£113.75
A15905-100ul 100ul
£192.50
A15905-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15905
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SF3B5; SF3b10; Ysf3; splicing factor 3B subunit 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SF3B5 (NP_112577.1).
Reactivity Human, Mouse, Rat
Gene ID 83443
Calculated MW 10kDa
Observed MW 11kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents