SETD5 Polyclonal AntibodySETD5 Polyclonal Antibody
Move your mouse over image or click to enlarge

SETD5 Polyclonal Antibody

Cat# Size Price Qty Buy
A14140-200ul 200ul
£332.50
A14140-100ul 100ul
£192.50
A14140-50ul 50ul
£113.75
A14140-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14140
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SETD5; SET domain containing 5
Applications IF, IHC
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 520-740 of human SETD5 (NP_001073986.1).
Reactivity Human
Gene ID 55209
Calculated MW 145kDa/147kDa/157kDa
Physical Appearance liquid
Purification Affinity purification
Sequence HAFENLEKRKKRRDQPLEQSNSDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPTEAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVECPLRITTDPTVLATTLNMLP
Sensitivity IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents