SERPINA10 Polyclonal AntibodySERPINA10 Polyclonal Antibody
Move your mouse over image or click to enlarge

SERPINA10 Polyclonal Antibody

Cat# Size Price Qty Buy
A4717-200ul 200ul
£332.50
A4717-100ul 100ul
£192.50
A4717-50ul 50ul
£113.75
A4717-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4717
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SERPINA10; PZI; ZPI; serpin family A member 10
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 165-444 of human SERPINA10 (NP_001094077.1).
Reactivity Human, Mouse, Rat
Gene ID 51156
Calculated MW 50kDa
Observed MW 51kDa
Physical Appearance liquid
Purification Affinity purification
Sequence FAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL
Sensitivity WB,1:500 - 1:2000|IF,1:20 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents