SEMA5B Polyclonal AntibodySEMA5B Polyclonal Antibody
Move your mouse over image or click to enlarge

SEMA5B Polyclonal Antibody

Cat# Size Price Qty Buy
A13819-200ul 200ul
£332.50
A13819-100ul 100ul
£192.50
A13819-50ul 50ul
£113.75
A13819-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13819
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SEMA5B; SEMAG; SemG; semaphorin-5B
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 800-980 of human SEMA5B (NP_001243276.1).
Reactivity Human
Gene ID 54437
Calculated MW 119kDa/123kDa/125kDa/131kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence RRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLADPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASC
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents