SCD5 Polyclonal AntibodySCD5 Polyclonal Antibody
Move your mouse over image or click to enlarge

SCD5 Polyclonal Antibody

Cat# Size Price Qty Buy
A13127-200ul 200ul
£332.50
A13127-100ul 100ul
£192.50
A13127-50ul 50ul
£113.75
A13127-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13127
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SCD5; ACOD4; FADS4; HSCD5; SCD2; SCD4; stearoyl-CoA desaturase 5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human SCD5 (NP_001032671.2).
Reactivity Human
Gene ID 79966
Calculated MW 28kDa/37kDa
Observed MW 38kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKAKPLTL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents