SAAL1 Polyclonal AntibodySAAL1 Polyclonal Antibody
Move your mouse over image or click to enlarge

SAAL1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13183-200ul 200ul
£332.50
A13183-100ul 100ul
£192.50
A13183-50ul 50ul
£113.75
A13183-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13183
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names SAAL1; SPACIA1; protein SAAL1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 175-474 of human SAAL1 (NP_612430.2).
Reactivity Human, Mouse, Rat
Gene ID 113174
Calculated MW 53kDa
Observed MW 54-58kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ERIQEHPAIYDSICFIMSSSTNVDLLVKVGEVVDKLFDLDEKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWLDVYMHILQLLTTVDDGIQAIVHCPDTGKDIWNLLFDLVCHEFCQSDDPPIILQEQKTVLASVFSVLSAIYASQTEQEYLKIEKVDLPLIDSLIRVLQNMEQCQKKPENSAESNTEETKRTDLTQDDFHLKILKDILCEFLSNIFQALTKETVAQGVKEGQLSKQKCSSAFQNLLPFYSPVVEDFIKILREVDKALADDLEKNFPSLKVQT
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents