RUBCN Polyclonal AntibodyRUBCN Polyclonal Antibody
Move your mouse over image or click to enlarge

RUBCN Polyclonal Antibody

Cat# Size Price Qty Buy
A13169-200ul 200ul
£332.50
A13169-100ul 100ul
£192.50
A13169-50ul 50ul
£113.75
A13169-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13169
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RUBCN; KIAA0226; RUBICON; SCAR15; RUN and cysteine rich domain containing beclin 1 interacting protein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RUBCN (NP_055502.1).
Reactivity Mouse
Gene ID 9711
Calculated MW 102kDa/103kDa/108kDa
Observed MW 108kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents