RSPH9 Polyclonal AntibodyRSPH9 Polyclonal Antibody
Move your mouse over image or click to enlarge

RSPH9 Polyclonal Antibody

Cat# Size Price Qty Buy
A15972-20ul 20ul
£77.00
A15972-50ul 50ul
£113.75
A15972-100ul 100ul
£192.50
A15972-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15972
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RSPH9; C6orf206; CILD12; MRPS18AL1; radial spoke head 9 homolog
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-276 of human RSPH9 (NP_689945.2).
Reactivity Human, Mouse, Rat
Gene ID 221421
Calculated MW 31kDa/34kDa
Observed MW 36kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents