RPUSD2 Polyclonal AntibodyRPUSD2 Polyclonal Antibody
Move your mouse over image or click to enlarge

RPUSD2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14397-200ul 200ul
£332.50
A14397-100ul 100ul
£192.50
A14397-50ul 50ul
£113.75
A14397-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14397
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RPUSD2; C15orf19; C18B11; RNA pseudouridylate synthase domain containing 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 286-545 of human RPUSD2 (NP_689473.1).
Reactivity Mouse, Rat
Gene ID 27079
Calculated MW 54kDa/61kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence TAAVSERIHEQVRDRQLEKEYVCRVEGEFPTEEVTCKEPILVVSYKVGVCRVDPRGKPCETVFQRLSYNGQSSVVRCRPLTGRTHQIRVHLQFLGHPILNDPIYNSVAWGPSRGRGGYIPKTNEELLRDLVAEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEEVAEAAPQELDTIALASEKAVETDVMNQETDPLCAECRLVRQDPLPQDLVMFLHALRYKGPGFEYFSPMPAWAQDDWQKD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents