ROR1 Polyclonal AntibodyROR1 Polyclonal Antibody
Move your mouse over image or click to enlarge

ROR1 Polyclonal Antibody

Cat# Size Price Qty Buy
A3315-200ul 200ul
£332.50
A3315-100ul 100ul
£192.50
A3315-50ul 50ul
£113.75
A3315-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3315
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ROR1; NTRKR1; dJ537F10.1; receptor tyrosine kinase like orphan receptor 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-200 of human ROR1 (NP_005003.2).
Reactivity Human, Mouse
Gene ID 4919
Calculated MW 42kDa/43kDa/104kDa
Observed MW 120kDa
Physical Appearance liquid
Purification Affinity purification
Sequence QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIEN
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents