ROBO4 Polyclonal AntibodyROBO4 Polyclonal Antibody
Move your mouse over image or click to enlarge

ROBO4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14134-200ul 200ul
£332.50
A14134-100ul 100ul
£192.50
A14134-50ul 50ul
£113.75
A14134-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14134
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names ROBO4; ECSM4; MRB; roundabout homolog 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 848-1007 of human ROBO4 (NP_061928.4).
Reactivity Human, Mouse
Gene ID 54538
Calculated MW 75kDa/98kDa/107kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence GVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARALAVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDWLEDMEVSHTQRLGRGMPPWPPDSQISSQRSQLHCRMPKAGASPVDYS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents