RHOF Polyclonal AntibodyRHOF Polyclonal Antibody
Move your mouse over image or click to enlarge

RHOF Polyclonal Antibody

Cat# Size Price Qty Buy
A4786-200ul 200ul
£332.50
A4786-100ul 100ul
£192.50
A4786-50ul 50ul
£113.75
A4786-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4786
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RHOF; ARHF; RIF; rho-related GTP-binding protein RhoF
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RHOF (NP_061907.2).
Reactivity Human, Mouse
Gene ID 54509
Calculated MW 18kDa/23kDa
Observed MW 27kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents