RGN Polyclonal AntibodyRGN Polyclonal Antibody
Move your mouse over image or click to enlarge

RGN Polyclonal Antibody

Cat# Size Price Qty Buy
A3350-200ul 200ul
£332.50
A3350-100ul 100ul
£192.50
A3350-50ul 50ul
£113.75
A3350-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3350
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RGN; GNL; HEL-S-41; RC; SMP30; regucalcin
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-299 of human RGN (NP_004674.1).
Reactivity Human, Mouse, Rat
Gene ID 9104
Calculated MW 24kDa/33kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents