RFPL4 Polyclonal AntibodyRFPL4 Polyclonal Antibody
Move your mouse over image or click to enlarge

RFPL4 Polyclonal Antibody

Cat# Size Price Qty Buy
A15981-20ul 20ul
£77.00
A15981-50ul 50ul
£113.75
A15981-100ul 100ul
£192.50
A15981-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15981
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RFPL4A; RFPL4; RNF210; ret finger protein-like 4A
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RFPL4 (NP_001138486.1).
Reactivity Human, Mouse, Rat
Gene ID 342931
Calculated MW 32kDa
Observed MW 32kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTF
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents