RFPL2 Polyclonal AntibodyRFPL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

RFPL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14604-200ul 200ul
£332.50
A14604-100ul 100ul
£192.50
A14604-50ul 50ul
£113.75
A14604-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14604
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RFPL2; RNF79; ret finger protein-like 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human RFPL2 (NP_006596.2).
Reactivity Human, Rat
Gene ID 10739
Calculated MW 32kDa/35kDa/42kDa
Observed MW 42kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PMSLECGCAVCLKCINSLQKEPHGEDLLCCCSSMVSRKNKIRRNRQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDANTANNFLLISDDLRSVRSG
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents