REXO4 Polyclonal AntibodyREXO4 Polyclonal Antibody
Move your mouse over image or click to enlarge

REXO4 Polyclonal Antibody

Cat# Size Price Qty Buy
A14414-200ul 200ul
£332.50
A14414-100ul 100ul
£192.50
A14414-50ul 50ul
£113.75
A14414-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14414
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names REXO4; REX4; XPMC2; XPMC2H; RNA exonuclease 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 70-240 of human REXO4 (NP_065118.2).
Reactivity Human
Gene ID 57109
Calculated MW 28kDa/46kDa
Observed MW 55kDa
Physical Appearance liquid
Purification Affinity purification
Sequence WKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents