RCBTB2 Polyclonal AntibodyRCBTB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

RCBTB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A3785-200ul 200ul
£332.50
A3785-100ul 100ul
£192.50
A3785-50ul 50ul
£113.75
A3785-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3785
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RCBTB2; CHC1L; RLG; RCC1 and BTB domain-containing protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 362-551 of human RCBTB2 (NP_001259.1).
Reactivity Human, Mouse, Rat
Gene ID 1102
Calculated MW 57kDa/60kDa
Observed MW 60kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TPAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFRSSLEDNEDDIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVGLLDLATFYRENRLKKLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKASRVGAFKN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents