RBX1 Polyclonal AntibodyRBX1 Polyclonal Antibody
Move your mouse over image or click to enlarge

RBX1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14500-200ul 200ul
£332.50
A14500-100ul 100ul
£192.50
A14500-50ul 50ul
£113.75
A14500-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14500
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBX1; BA554C12.1; RNF75; ROC1; ring-box 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBX1 (NP_055063.1).
Reactivity Mouse, Rat
Gene ID 9978
Calculated MW 12kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents