RBSN Polyclonal AntibodyRBSN Polyclonal Antibody
Move your mouse over image or click to enlarge

RBSN Polyclonal Antibody

Cat# Size Price Qty Buy
A13792-200ul 200ul
£332.50
A13792-100ul 100ul
£192.50
A13792-50ul 50ul
£113.75
A13792-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13792
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBSN; Rabenosyn-5; ZFYVE20; rabenosyn-5
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human RBSN (NP_071735.2).
Reactivity Mouse
Gene ID 64145
Calculated MW 23kDa/88kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence MASLDDPGEVREGFLCPLCLKDLQSFYQLHSHYEEEHSGEDRDVKGQIKSLVQKAKKAKDRLLKREGDDRAESGTQGYESFSYGGVDPYMWEPQELGAVRSHLSDFKKHRAARIDHYVVEVNKLIIRLEKLTAFDRTNTESAKIRAIEKSVVPWVNDQDVPFCPDCGNKFSIRNRRHHCRLCGSIMCKKCMELISLPLAN
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents