RBP7 Polyclonal AntibodyRBP7 Polyclonal Antibody
Move your mouse over image or click to enlarge

RBP7 Polyclonal Antibody

Cat# Size Price Qty Buy
A15939-20ul 20ul
£77.00
A15939-50ul 50ul
£113.75
A15939-100ul 100ul
£192.50
A15939-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A15939
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBP7; CRABP4; CRBP4; CRBPIV; retinol binding protein 7
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human RBP7 (NP_443192.1).
Reactivity Mouse, Rat
Gene ID 116362
Calculated MW 15kDa
Observed MW 15kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents