RBP4 Polyclonal AntibodyRBP4 Polyclonal Antibody
Move your mouse over image or click to enlarge

RBP4 Polyclonal Antibody

Cat# Size Price Qty Buy
A1600-20ul 20ul
£77.00
A1600-50ul 50ul
£113.75
A1600-100ul 100ul
£192.50
A1600-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A1600
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBP4; MCOPCB10; RDCCAS; retinol-binding protein 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-201 of human RBP4 (NP_006735.2).
Reactivity Human, Mouse
Gene ID 5950
Calculated MW 23kDa
Observed MW 23kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents