RBM26 Polyclonal AntibodyRBM26 Polyclonal Antibody
Move your mouse over image or click to enlarge

RBM26 Polyclonal Antibody

Cat# Size Price Qty Buy
A13120-200ul 200ul
£332.50
A13120-100ul 100ul
£192.50
A13120-50ul 50ul
£113.75
A13120-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13120
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBM26; ARRS2; C13orf10; PPP1R132; PRO1777; SE70-2; ZC3H17; RNA-binding protein 26
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 65-140 of human RBM26 (NP_071401.3).
Reactivity Mouse, Rat
Gene ID 64062
Calculated MW 13kDa/60kDa/62kDa/110kDa/111kDa/113kDa
Observed MW 113kDa
Physical Appearance liquid
Purification Affinity purification
Sequence TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents