RBM17 Polyclonal AntibodyRBM17 Polyclonal Antibody
Move your mouse over image or click to enlarge

RBM17 Polyclonal Antibody

Cat# Size Price Qty Buy
A3240-200ul 200ul
£332.50
A3240-100ul 100ul
£192.50
A3240-50ul 50ul
£113.75
A3240-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3240
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBM17; SPF45; splicing factor 45
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human RBM17 (NP_116294.1).
Reactivity Human, Mouse, Rat
Gene ID 84991
Calculated MW 44kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKDRHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPPPVYEEQDRPRSPTGPSNSFLANMGGTVAH
Sensitivity WB,1:200 - 1:2000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents