RBL2 Polyclonal AntibodyRBL2 Polyclonal Antibody
Move your mouse over image or click to enlarge

RBL2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13649-200ul 200ul
£332.50
A13649-100ul 100ul
£192.50
A13649-50ul 50ul
£113.75
A13649-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13649
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RBL2; P130; Rb2; retinoblastoma-like protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RBL2 (NP_005602.3).
Reactivity Human
Gene ID 5934
Calculated MW 59kDa/128kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence PTVSKGTVEGNYVSLTRILKCSEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPRQQRGRKQRRQPCTVSEI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents