RAPGEF4 Polyclonal AntibodyRAPGEF4 Polyclonal Antibody
Move your mouse over image or click to enlarge

RAPGEF4 Polyclonal Antibody

Cat# Size Price Qty Buy
A4484-200ul 200ul
£332.50
A4484-100ul 100ul
£192.50
A4484-50ul 50ul
£113.75
A4484-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4484
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RAPGEF4; CAMP-GEFII; CGEF2; EPAC; EPAC 2; EPAC2; Nbla00496; rap guanine nucleotide exchange factor 4
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human RAPGEF4 (NP_001093867.1).
Reactivity Human, Mouse, Rat
Gene ID 11069
Calculated MW 79kDa/96kDa/98kDa/99kDa/115kDa
Observed MW 115kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MLYKKYRQYMAGLLAPPYGVMETGSNNDRIPDKENTPLIEPHVPLRPANTITKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHI
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents