RAPGEF1 Polyclonal AntibodyRAPGEF1 Polyclonal Antibody
Move your mouse over image or click to enlarge

RAPGEF1 Polyclonal Antibody

Cat# Size Price Qty Buy
A16050-20ul 20ul
£77.00
A16050-50ul 50ul
£113.75
A16050-100ul 100ul
£192.50
A16050-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16050
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RAPGEF1; C3G; GRF2; rap guanine nucleotide exchange factor 1
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 844-1095 of human RAPGEF1 (NP_941372.1).
Reactivity Human, Mouse, Rat
Gene ID 2889
Calculated MW 116kDa/120kDa/122kDa
Observed MW Refer to figures
Physical Appearance liquid
Purification Affinity purification
Sequence ARGVAARPGTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILDSMRCFQQAHYDMRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEKT
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:100|IF,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents