RAP2B Polyclonal AntibodyRAP2B Polyclonal Antibody
Move your mouse over image or click to enlarge

RAP2B Polyclonal Antibody

Cat# Size Price Qty Buy
A4071-200ul 200ul
£332.50
A4071-100ul 100ul
£192.50
A4071-50ul 50ul
£113.75
A4071-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4071
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RAP2B; ras-related protein Rap-2b
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human RAP2B (NP_002877.2).
Reactivity Human, Mouse, Rat
Gene ID 5912
Calculated MW 20kDa
Observed MW 18kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL
Sensitivity WB,1:100 - 1:500
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents