RANKL Polyclonal AntibodyRANKL Polyclonal Antibody
Move your mouse over image or click to enlarge

RANKL Polyclonal Antibody

Cat# Size Price Qty Buy
A13567-200ul 200ul
£332.50
A13567-100ul 100ul
£192.50
A13567-50ul 50ul
£113.75
A13567-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13567
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names TNFSF11; CD254; ODF; OPGL; OPTB2; RANKL; TNLG6B; TRANCE; hRANKL2; sOdf; TNF superfamily member 11
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 78-317 of human RANKL (NP_003692.1).
Reactivity Human, Mouse, Rat
Gene ID 8600
Calculated MW 27kDa/30kDa/35kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence RISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Sensitivity WB,1:500 - 1:1000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents