RANGAP1 Polyclonal AntibodyRANGAP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

RANGAP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A13347-200ul 200ul
£332.50
A13347-100ul 100ul
£192.50
A13347-50ul 50ul
£113.75
A13347-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13347
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RANGAP1; Fug1; RANGAP; SD; ran GTPase-activating protein 1
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 398-587 of human RANGAP1 (NP_002874.1).
Reactivity Duck, Human
Gene ID 5905
Calculated MW 63kDa
Observed MW 64/90kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents