RAD52 Polyclonal AntibodyRAD52 Polyclonal Antibody
Move your mouse over image or click to enlarge

RAD52 Polyclonal Antibody

Cat# Size Price Qty Buy
A3077-200ul 200ul
£332.50
A3077-100ul 100ul
£192.50
A3077-50ul 50ul
£113.75
A3077-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3077
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RAD52; DNA repair protein RAD52 homolog
Applications IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 125-418 of human RAD52 (NP_602296.2).
Reactivity Human, Mouse, Rat
Gene ID 5893
Calculated MW 12kDa/15kDa/24kDa/46kDa
Observed MW 46kDa
Physical Appearance liquid
Purification Affinity purification
Sequence GYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Sensitivity WB,1:500 - 1:1000|IHC,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents