RAD50 Polyclonal AntibodyRAD50 Polyclonal Antibody
Move your mouse over image or click to enlarge

RAD50 Polyclonal Antibody

Cat# Size Price Qty Buy
A3078-200ul 200ul
£332.50
A3078-100ul 100ul
£192.50
A3078-50ul 50ul
£113.75
A3078-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A3078
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RAD50; NBSLD; RAD502; hRad50; DNA repair protein RAD50
Applications IF, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAD50 (NP_005723.2).
Reactivity Human, Mouse, Rat
Gene ID 10111
Calculated MW 138kDa/153kDa/154kDa
Observed MW 170kDa
Physical Appearance liquid
Purification Affinity purification
References PMID 28481869
Sequence MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSM
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200|IP,1:20 - 1:50
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents