RAD18 Polyclonal AntibodyRAD18 Polyclonal Antibody
Move your mouse over image or click to enlarge

RAD18 Polyclonal Antibody

Cat# Size Price Qty Buy
A13434-200ul 200ul
£332.50
A13434-100ul 100ul
£192.50
A13434-50ul 50ul
£113.75
A13434-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13434
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RAD18; RNF73; E3 ubiquitin-protein ligase RAD18
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 216-495 of human RAD18 (NP_064550.3).
Reactivity Human, Mouse, Rat
Gene ID 56852
Calculated MW 56kDa
Observed MW 80kDa
Physical Appearance liquid
Purification Affinity purification
Sequence INKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents