RABEPK Polyclonal AntibodyRABEPK Polyclonal Antibody
Move your mouse over image or click to enlarge

RABEPK Polyclonal Antibody

Cat# Size Price Qty Buy
A4391-200ul 200ul
£332.50
A4391-100ul 100ul
£192.50
A4391-50ul 50ul
£113.75
A4391-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4391
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RABEPK; RAB9P40; bA65N13.1; p40; rab9 effector protein with kelch motifs
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human RABEPK (NP_005824.2).
Reactivity Human
Gene ID 10244
Calculated MW 34kDa/40kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAP
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents