RAB37 Polyclonal AntibodyRAB37 Polyclonal Antibody
Move your mouse over image or click to enlarge

RAB37 Polyclonal Antibody

Cat# Size Price Qty Buy
A13704-200ul 200ul
£332.50
A13704-100ul 100ul
£192.50
A13704-50ul 50ul
£113.75
A13704-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13704
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names RAB37; ras-related protein Rab-37
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 144-223 of human RAB37 (NP_001006639.1).
Reactivity Human, Mouse, Rat
Gene ID 326624
Calculated MW 20kDa/24kDa/25kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence KADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRSSCCSFM
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents