PWP1 Polyclonal AntibodyPWP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

PWP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A14579-200ul 200ul
£332.50
A14579-100ul 100ul
£192.50
A14579-50ul 50ul
£113.75
A14579-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14579
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PWP1; IEF-SSP-9502; PWP1 homolog, endonuclein
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PWP1 (NP_008993.1).
Reactivity Mouse
Gene ID 11137
Calculated MW 16kDa/55kDa
Observed MW Refer to Figures
Physical Appearance liquid
Purification Affinity purification
Sequence MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEKLQEEGGGSDEEETGSPSEDGMQSARTQARPREPLEDGDPEDDRTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents