PTPN22 Polyclonal AntibodyPTPN22 Polyclonal Antibody
Move your mouse over image or click to enlarge

PTPN22 Polyclonal Antibody

Cat# Size Price Qty Buy
A1406-200ul 200ul
£332.50
A1406-100ul 100ul
£192.50
A1406-50ul 50ul
£113.75
A1406-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A1406
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PTPN22; LYP; LYP1; LYP2; PEP; PTPN22.5; PTPN22.6; PTPN8; tyrosine-protein phosphatase non-receptor type 22
Applications IF, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PTPN22 (NP_036543.4).
Reactivity Human, Mouse, Rat
Gene ID 26191
Calculated MW 20kDa/75kDa/78kDa/85kDa/88kDa/91kDa
Observed MW 107kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFI
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents