PTK2B Polyclonal AntibodyPTK2B Polyclonal Antibody
Move your mouse over image or click to enlarge

PTK2B Polyclonal Antibody

Cat# Size Price Qty Buy
A16045-20ul 20ul
£77.00
A16045-50ul 50ul
£113.75
A16045-100ul 100ul
£192.50
A16045-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16045
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PTK2B; CADTK; CAKB; FADK2; FAK2; PKB; PTK; PYK2; RAFTK; protein-tyrosine kinase 2-beta
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTK2B (NP_004094.3).
Reactivity Human, Mouse, Rat
Gene ID 2185
Calculated MW 111kDa/115kDa
Observed MW 116kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents