PTGER3 Polyclonal AntibodyPTGER3 Polyclonal Antibody
Move your mouse over image or click to enlarge

PTGER3 Polyclonal Antibody

Cat# Size Price Qty Buy
A4057-200ul 200ul
£332.50
A4057-100ul 100ul
£192.50
A4057-50ul 50ul
£113.75
A4057-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4057
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PTGER3; EP3; EP3-I; EP3-II; EP3-III; EP3-IV; EP3-VI; EP3e; PGE2-R; prostaglandin E receptor 3
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-53 of human PTGER3 (NP_942009.1).
Reactivity Mouse, Rat
Gene ID 5733
Calculated MW 40kDa/41kDa/42kDa/43kDa/44kDa/46kDa/47kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents