PSMC3 Polyclonal AntibodyPSMC3 Polyclonal Antibody
Move your mouse over image or click to enlarge

PSMC3 Polyclonal Antibody

Cat# Size Price Qty Buy
A13345-200ul 200ul
£332.50
A13345-100ul 100ul
£192.50
A13345-50ul 50ul
£113.75
A13345-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13345
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PSMC3; TBP1; proteasome 26S subunit, ATPase 3
Applications IF, IP, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PSMC3 (NP_002799.3).
Reactivity Human
Gene ID 5702
Calculated MW 49kDa
Observed MW 50kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQ
Sensitivity WB,1:500 - 1:2000|IF,1:50 - 1:200|IP,1:50 - 1:100
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents