PSMB2 Polyclonal AntibodyPSMB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PSMB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13630-200ul 200ul
£332.50
A13630-100ul 100ul
£192.50
A13630-50ul 50ul
£113.75
A13630-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13630
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PSMB2; HC7-I; proteasome subunit beta 2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human PSMB2 (NP_002785.1).
Reactivity Human
Gene ID 5690
Calculated MW 22kDa
Observed MW 23kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents