PSD2 Polyclonal AntibodyPSD2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PSD2 Polyclonal Antibody

Cat# Size Price Qty Buy
A14429-200ul 200ul
£332.50
A14429-100ul 100ul
£192.50
A14429-50ul 50ul
£113.75
A14429-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14429
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PSD2; EFA6C; PH and SEC7 domain-containing protein 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PSD2 (NP_115665.1).
Reactivity Human, Mouse, Rat
Gene ID 84249
Calculated MW 84kDa
Observed MW 85kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEPTKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAEDPQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPLTPLIQQRARD
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents