PROZ Polyclonal AntibodyPROZ Polyclonal Antibody
Move your mouse over image or click to enlarge

PROZ Polyclonal Antibody

Cat# Size Price Qty Buy
A16082-20ul 20ul
£77.00
A16082-50ul 50ul
£113.75
A16082-100ul 100ul
£192.50
A16082-200ul 200ul
£332.50

Additional Information

Property Value or Rating
Manufacturer Cat# A16082
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PROZ; PZ; vitamin K-dependent protein Z
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-340 of human PROZ (NP_003882.1).
Reactivity Human, Mouse, Rat
Gene ID 8858
Calculated MW 44kDa/47kDa
Observed MW 48kDa
Physical Appearance liquid
Purification Affinity purification
Sequence SLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTY
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents