PRKCZ Polyclonal AntibodyPRKCZ Polyclonal Antibody
Move your mouse over image or click to enlarge

PRKCZ Polyclonal Antibody

Cat# Size Price Qty Buy
A14178-200ul 200ul
£332.50
A14178-100ul 100ul
£192.50
A14178-50ul 50ul
£113.75
A14178-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14178
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PRKCZ; PKC-ZETA; PKC2; protein kinase C zeta
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 453-592 of human PRKCZ (NP_002735.3).
Reactivity Human, Mouse, Rat
Gene ID 5590
Calculated MW 46kDa/56kDa/67kDa
Observed MW 78kDa
Physical Appearance liquid
Purification Affinity purification
Sequence IITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents