PRKCA Polyclonal AntibodyPRKCA Polyclonal Antibody
Move your mouse over image or click to enlarge

PRKCA Polyclonal Antibody

Cat# Size Price Qty Buy
A13342-200ul 200ul
£332.50
A13342-100ul 100ul
£192.50
A13342-50ul 50ul
£113.75
A13342-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13342
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PRKCA; AAG6; PKC-alpha; PKCA; PRKACA; protein kinase C alpha
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 523-672 of human PRKCA (NP_002728.1).
Reactivity Human, Mouse, Rat
Gene ID 5578
Calculated MW 76kDa
Observed MW 85kDa
Physical Appearance liquid
Purification Affinity purification
Sequence AYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents