PRKAB2 Polyclonal AntibodyPRKAB2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PRKAB2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13341-200ul 200ul
£332.50
A13341-100ul 100ul
£192.50
A13341-50ul 50ul
£113.75
A13341-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13341
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PRKAB2; 5'-AMP-activated protein kinase subunit beta-2
Applications IF, IHC, WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-272 of human PRKAB2 (NP_005390.1).
Reactivity Human, Mouse, Rat
Gene ID 5565
Calculated MW 21kDa/30kDa
Observed MW 35kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
Sensitivity WB,1:500 - 1:2000|IHC,1:50 - 1:200|IF,1:50 - 1:200
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents