PREB Polyclonal AntibodyPREB Polyclonal Antibody
Move your mouse over image or click to enlarge

PREB Polyclonal Antibody

Cat# Size Price Qty Buy
A14347-200ul 200ul
£332.50
A14347-100ul 100ul
£192.50
A14347-50ul 50ul
£113.75
A14347-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A14347
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PREB; SEC12; prolactin regulatory element binding
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 13-202 of human PREB (NP_037520.1).
Reactivity Human, Mouse
Gene ID 10113
Calculated MW 45kDa
Observed MW 45kDa
Physical Appearance liquid
Purification Affinity purification
Sequence PFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDL
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents