PRDM2 Polyclonal AntibodyPRDM2 Polyclonal Antibody
Move your mouse over image or click to enlarge

PRDM2 Polyclonal Antibody

Cat# Size Price Qty Buy
A13157-200ul 200ul
£332.50
A13157-100ul 100ul
£192.50
A13157-50ul 50ul
£113.75
A13157-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A13157
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PRDM2; HUMHOXY1; KMT8; KMT8A; MTB-ZF; RIZ; RIZ1; RIZ2; PR/SET domain 2
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PRDM2 (NP_036363.2).
Reactivity Human, Mouse, Rat
Gene ID 7799
Calculated MW 25kDa/162kDa/166kDa/184kDa/188kDa
Observed MW 300kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAA
Sensitivity WB,1:500 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents