PRCP Polyclonal AntibodyPRCP Polyclonal Antibody
Move your mouse over image or click to enlarge

PRCP Polyclonal Antibody

Cat# Size Price Qty Buy
A4040-200ul 200ul
£332.50
A4040-100ul 100ul
£192.50
A4040-50ul 50ul
£113.75
A4040-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4040
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PRCP; HUMPCP; PCP; prolylcarboxypeptidase
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 407-496 of human PRCP (NP_005031.1).
Reactivity Rat
Gene ID 5547
Calculated MW 55kDa/58kDa
Observed MW 56kDa
Physical Appearance liquid
Purification Affinity purification
Sequence ITTMYGGKNISSHTNIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYDSAGKQH
Sensitivity WB,1:1000 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents