PQBP1 Polyclonal AntibodyPQBP1 Polyclonal Antibody
Move your mouse over image or click to enlarge

PQBP1 Polyclonal Antibody

Cat# Size Price Qty Buy
A4369-200ul 200ul
£332.50
A4369-100ul 100ul
£192.50
A4369-50ul 50ul
£113.75
A4369-20ul 20ul
£77.00

Additional Information

Property Value or Rating
Manufacturer Cat# A4369
Manufacturer Abclonal Biotechnology
Antibody Type Polyclonal
Alternate Names PQBP1; MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS; polyglutamine-binding protein 1
Applications WB
Buffer Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Conjugate Unconjugated
Host Rabbit
Isotype IgG
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human PQBP1 (NP_005701.1).
Reactivity Human, Mouse, Rat
Gene ID 10084
Calculated MW 6kDa/7kDa/8kDa/14kDa/17kDa/18kDa/26kDa/30kDa
Observed MW 30kDa
Physical Appearance liquid
Purification Affinity purification
Sequence MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
Sensitivity WB,1:200 - 1:2000
Storage Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Related Documents